| Ãû³Æ | Ras-related C3 botulinum toxin substrate 2 Protein |
| ´¿¶È | >85% |
| ËÞÖ÷ϸ°û | HEK293 |
| ÐòÁÐ | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL |
| »ùÒòÃû | RAC2 |
| Uniprot ID | P15153 |
| ÎïÖÖ | Homo sapiens(Human) |
| ²úÆ·ÐÔ×´ | Liquid |
| »º³åÒº | 1¡ÁPBS£¬pH7.4 |
| ´¢´æ·½Ê½ | -80 ¡æ packaging and storage to avoid repeated freezing and thawing. |
| SDS-PAGE &WB |
|
Plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as secretory processes, phagocytose of apoptotic cells and epithelial cell polarization. Augments the production of reactive oxygen species (ROS) by NADPH oxidase.