| Ãû³Æ | Artemin Protein |
| ´¿¶È | >90% |
| ËÞÖ÷ϸ°û | HEK293 |
| ÐòÁÐ | MELGLGGLSTLSHCPWPRQQPALWPTLAALALLSSVAEASLGSAPRSPAPREGPPPVLASPAGHLPGGRTARWCSGRARRPPPQPSRPAPPPPAPPSALPRGGRAARAGGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG |
| »ùÒòÃû | ARTN |
| Uniprot ID | Q5T4W7 |
| ÎïÖÖ | Homo sapiens(Human) |
| ²úÆ·ÐÔ×´ | Liquid |
| »º³åÒº | 1¡ÁPBS£¬pH7.4 |
| ´¢´æ·½Ê½ | -80 ¡æ packaging and storage to avoid repeated freezing and thawing. |
| SDS-PAGE &WB |
|
Growth factor that supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain (PubMed:10583383, PubMed:9883723). Acts by binding to its coreceptor, GFRA3, leading to autophosphorylation and activation of the RET receptor (PubMed:31535977). Strong attractant of gut hematopoietic cells thus promoting the formation Peyer's patch-like structures, a major component of the gut-associated lymphoid tissue (By similarity).